PDB entry 2x77

View 2x77 on RCSB PDB site
Description: crystal structure of leishmania major ADP ribosylation factor-like 1.
Class: GTP-binding protein
Keywords: GTP-binding protein, small gtpase, nucleotide-binding
Deposited on 2010-02-24, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21773
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x77a_
  • Chain 'B':
    Compound: ADP-ribosylation factor
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x77b_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x77A (A:)
    ghmgawlaslkqtlgllpadrkirvlmlgldnagktsilyrlhlgdvvttvptvgvnlet
    lqyknisfevwdlggqtgvrpywrcyfsdtdaviyvvdstdrdrmgvakhelyalldede
    lrkslllifankqdlpdaaseaeiaeqlgvssimnrtwtivksssktgdglvegmdwlve
    rlreqglga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x77A (A:)
    wlaslkqtlgllpadrkirvlmlgldnagktsilyrlhlgdvvttvptvgvnletlqykn
    isfevwdlggqtgvrpywrcyfsdtdaviyvvdstdrdrmgvakhelyalldedelrksl
    llifankqdlpdaaseaeiaeqlgvssimnrtwtivksssktgdglvegmdwlverlreq
    g
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x77B (B:)
    ghmgawlaslkqtlgllpadrkirvlmlgldnagktsilyrlhlgdvvttvptvgvnlet
    lqyknisfevwdlggqtgvrpywrcyfsdtdaviyvvdstdrdrmgvakhelyalldede
    lrkslllifankqdlpdaaseaeiaeqlgvssimnrtwtivksssktgdglvegmdwlve
    rlreqglga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x77B (B:)
    awlaslkqtlgllpadrkirvlmlgldnagktsilyrlhlgdvvttnletlqyknisfev
    wdlggcyfsdtdaviyvvdstdrdrmgvakhelyalldedelrkslllifankqdlpdaa
    seaeiaeqlgvssimnrtwtivksssktgdglvegmdwlverlreq