PDB entry 2x6c

View 2x6c on RCSB PDB site
Description: Potassium Channel from Magnetospirillum Magnetotacticum
Class: metal transport
Keywords: integral membrane protein, ion channel, metal transport
Deposited on 2010-02-15, released 2010-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2208
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-sensitive inward rectifier potassium channel 10
    Species: Magnetospirillum magnetotacticum [TaxId:188]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X6C (295-End)
    Domains in SCOPe 2.06: d2x6ca1, d2x6ca2, d2x6ca3
  • Heterogens: PC, SM, K, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x6cA (A:)
    mtggmkpparkprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvt
    nalfalaylacgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcg
    mlglavaasliyarftrptagvlfssrmvisdfegkptlmmrlanlrieaiieadvhlvl
    vrseisqegmvfrrfhdltltrsrspifslswtvmhpidhhspiygetdetlrnshsefl
    vlftghheafaqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x6cA (A:)
    prilnsdgssnitrlghyhdlltvswpvfitlitglylvtnalfalaylagdvienafff
    svqtmatigygkliptlvtlealcgmlglavaasliyarftrptagvlfssrmvisdfeg
    kptlmmrlanlrieaiieadvhlvlvrseisqegmvfrrfhdltltrsrspifslswtvm
    hpidhhspiygetdetlrnshseflvlftghheafaqnvharhayscdeiiwgghfvdvf
    ttlpdgrraldlgkfheiaqhhhh