PDB entry 2x36

View 2x36 on RCSB PDB site
Description: structure of the proteolytic domain of the human mitochondrial lon protease
Class: hydrolase
Keywords: hydrolase, catalytic dyad, transit peptide, mitochondria
Deposited on 2010-01-21, released 2010-05-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19549
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lon protease homolog, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2x36a_
  • Chain 'B':
    Compound: lon protease homolog, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2x36b_
  • Chain 'C':
    Compound: lon protease homolog, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2x36c_
  • Chain 'D':
    Compound: lon protease homolog, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2x36d_
  • Chain 'E':
    Compound: lon protease homolog, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2x36e_
  • Chain 'F':
    Compound: lon protease homolog, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2x36f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x36A (A:)
    vermydvtppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmke
    sariaytfaraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrp
    vrqnlamtgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafitegle
    vhfvehyreifdiafpdeqaealaver
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x36A (A:)
    mydvtppgvvmglawtamggstlfvetslrrpqdgslevtgqlgevmkesariaytfara
    flmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamtgev
    sltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyreif
    diafpdeqae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x36B (B:)
    vermydvtppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmke
    sariaytfaraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrp
    vrqnlamtgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafitegle
    vhfvehyreifdiafpdeqaealaver
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x36B (B:)
    mydvtppgvvmglawtamggstlfvetslgslevtgqlgevmkesariaytfaraflmqh
    apandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamtgevsltgk
    ilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyreifdiafp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2x36C (C:)
    vermydvtppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmke
    sariaytfaraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrp
    vrqnlamtgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafitegle
    vhfvehyreifdiafpdeqaealaver
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x36C (C:)
    rmydvtppgvvmglawtamggstlfvetslrrpqkdgslevtgqlgevmkesariaytfa
    raflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamtg
    evsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyre
    ifdiafpdeqae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2x36D (D:)
    vermydvtppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmke
    sariaytfaraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrp
    vrqnlamtgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafitegle
    vhfvehyreifdiafpdeqaealaver
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x36D (D:)
    tppgvvmglawtamggstlfvetslrdgslevtgqlgevmkesariaytfaraflmqhap
    andylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamtgevsltgkil
    pvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyreifdiafp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2x36E (E:)
    vermydvtppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmke
    sariaytfaraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrp
    vrqnlamtgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafitegle
    vhfvehyreifdiafpdeqaealaver
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x36E (E:)
    dvtppgvvmglawtamggstlfvetslrrdgslevtgqlgevmkesariaytfaraflmq
    hapandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamtgevsltg
    kilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyreifdiaf
    p
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2x36F (F:)
    vermydvtppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmke
    sariaytfaraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrp
    vrqnlamtgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafitegle
    vhfvehyreifdiafpdeqaealaver
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x36F (F:)
    vtppgvvmglawtamggstlfvetslrdgslevtgqlgevmkesariaytfaraflmqha
    pandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamtgevsltgki
    lpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyreifdiafp