PDB entry 2x2y

View 2x2y on RCSB PDB site
Description: cellulomonas fimi endo-beta-1,4-mannanase double mutant
Class: hydrolase
Keywords: clan gh-a, family 26, hydrolase, glycoside hydrolase
Deposited on 2010-01-18, released 2010-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.15997
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: man26a
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XCV5 (Start-463)
      • expression tag (464)
      • engineered mutation (322)
      • engineered mutation (324)
    Domains in SCOPe 2.06: d2x2ya1, d2x2ya2, d2x2ya3
  • Chain 'B':
    Compound: man26a
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XCV5 (Start-463)
      • expression tag (464)
      • engineered mutation (322)
      • engineered mutation (324)
    Domains in SCOPe 2.06: d2x2yb1, d2x2yb2, d2x2yb3
  • Heterogens: MG, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x2yA (A:)
    madetiaivdadataetrsllsyldgvrgegilfghqhttsfglttgptdgttsdvknvt
    gdfpavfgwdtliiegnerpglaentrdenialfadyirkadaiggvntvsahvenfvtg
    gsfydtsgdtlravlpggshhaelvaylddiaeladasrrddgtlipivfrpwhenagsw
    fwwgaaygspgeyqelyrftveylrdvkgvsnflyawgpgggfggnrdvylrtypgdafv
    dvlgldtydstgsdaflaglvadlrmiaeiadekgkvsaftefgvsggvgtngsspaqwf
    tkvlaaikadpvasrnaymetwrnadagqhfvpvpgdalledfqayaadpftlfasevtg
    afdrtvaaapaqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqggtvvdtld
    laydgalwwtapwsptsaqldnstytvtatattaagtldvtnevaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x2yA (A:)
    etiaivdadataetrsllsyldgvrgegilfghqhttsfglttgptdgttsdvknvtgdf
    pavfgwdtliiegnerpglaentrdenialfadyirkadaiggvntvsahvenfvtggsf
    ydtsgdtlravlpggshhaelvaylddiaeladasrrddgtlipivfrpwhenagswfww
    gaaygspgeyqelyrftveylrdvkgvsnflyawgpgggfggnrdvylrtypgdafvdvl
    gldtydstgsdaflaglvadlrmiaeiadekgkvsaftefgvsggvgtngsspaqwftkv
    laaikadpvasrnaymetwrnadagqhfvpvpgdalledfqayaadpftlfasevtgafd
    rtvaaapaqpvvhiaspadgarvpttvrvrvggtdvqsvtvevaqtvvdtldlaydgalw
    wtapwspstytvtatattaagtldvtneva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x2yB (B:)
    madetiaivdadataetrsllsyldgvrgegilfghqhttsfglttgptdgttsdvknvt
    gdfpavfgwdtliiegnerpglaentrdenialfadyirkadaiggvntvsahvenfvtg
    gsfydtsgdtlravlpggshhaelvaylddiaeladasrrddgtlipivfrpwhenagsw
    fwwgaaygspgeyqelyrftveylrdvkgvsnflyawgpgggfggnrdvylrtypgdafv
    dvlgldtydstgsdaflaglvadlrmiaeiadekgkvsaftefgvsggvgtngsspaqwf
    tkvlaaikadpvasrnaymetwrnadagqhfvpvpgdalledfqayaadpftlfasevtg
    afdrtvaaapaqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqggtvvdtld
    laydgalwwtapwsptsaqldnstytvtatattaagtldvtnevaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x2yB (B:)
    etiaivdadataetrsllsyldgvrgegilfghqhttsfglttgptdgttsdvknvtgdf
    pavfgwdtliiegnerpglaentrdenialfadyirkadaiggvntvsahvenfvtggsf
    ydtsgdtlravlpggshhaelvaylddiaeladasrrddgtlipivfrpwhenagswfww
    gaaygspgeyqelyrftveylrdvkgvsnflyawgpgggfggnrdvylrtypgdafvdvl
    gldtydstgsdaflaglvadlrmiaeiadekgkvsaftefgvsggvgtngsspaqwftkv
    laaikadpvasrnaymetwrnadagqhfvpvpgdalledfqayaadpftlfasevtgafd
    rtvaaapaqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqtvvdtldlaydg
    alwwtapwspytvtatattaagtldvtneva