PDB entry 2x2d

View 2x2d on RCSB PDB site
Description: acetyl-cypa:hiv-1 n-term capsid domain complex
Class: isomerase/viral protein
Keywords: isomerase-viral protein complex, isomerase viral protein complex, viral protein, isomerase, host-virus interaction
Deposited on 2010-01-12, released 2010-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19974
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x2db_
  • Chain 'C':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2x2dc_
  • Chain 'D':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X2D
    • Uniprot P12493 (1-146)
    Domains in SCOPe 2.07: d2x2dd_
  • Chain 'E':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X2D
    • Uniprot P12493 (Start-146)
    Domains in SCOPe 2.07: d2x2de_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x2dB (B:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2x2dC (C:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x2dC (C:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2x2dD (D:)
    mpivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntv
    gghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmt
    hnppipvgeiykrwiilglnkivrmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x2dD (D:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2x2dE (E:)
    mpivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntv
    gghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmt
    hnppipvgeiykrwiilglnkivrmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x2dE (E:)
    vhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlk
    etineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipvgeiy
    krwiilglnkivrmys