PDB entry 2x2a

View 2x2a on RCSB PDB site
Description: free acetyl-cypa trigonal form
Class: isomerase
Keywords: hiv-1, isomerase, host-virus interaction
Deposited on 2010-01-12, released 2010-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.12511
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62937 (0-164)
      • conflict (119)
    Domains in SCOPe 2.07: d2x2aa_
  • Chain 'B':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62937 (Start-164)
      • conflict (119)
    Domains in SCOPe 2.07: d2x2ab_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x2aA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktk
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x2aB (B:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktk
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x2aB (B:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktkw
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle