PDB entry 2x1v

View 2x1v on RCSB PDB site
Description: crystal structure of the activating h-ras i163f mutant in costello syndrome, bound to mg-GDP
Class: hydrolase
Keywords: s-nitrosylation, disease mutation, palmitate, hydrolase, methylation, prenylation, cell membrane, proto-oncogene, gtpase protein, golgi apparatus
Deposited on 2010-01-04, released 2010-01-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.1907
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112
      • engineered mutation (162)
    Domains in SCOPe 2.04: d2x1va_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x1vA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvrefrqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1vA (A:)
    teyklvvvgaggvgksaltiqliqnhfvdsyrkqvvidgetclldildtaegflcvfain
    ntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaqdlarsygipyiets
    aktrqgvedafytlvrefr