PDB entry 2x1q

View 2x1q on RCSB PDB site
Description: gelsolin nanobody
Class: contractile protein
Keywords: contractile protein
Deposited on 2010-01-03, released 2011-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: 0.214
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gelsolin nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2X1Q (Start-126)
    Domains in SCOPe 2.07: d2x1qa1, d2x1qa2
  • Chain 'B':
    Compound: gelsolin nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2X1Q (Start-126)
    Domains in SCOPe 2.07: d2x1qb1, d2x1qb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x1qA (A:)
    qvqlqesggglvqpggslrlscaasgrtfsnyrmgwfrqapgkerefvatisqsgaatay
    adsvkgrftfsrdnaknllylemlslepedtavyycaassrvfytevlqtttgydywgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1qA (A:)
    qlqesggglvqpggslrlscasnyrmgwfrqapgkerefvatisqsgaatayadsvkgrf
    tfsrdnaknllylemlslepedtavyycaassrvfytevlqtttgydywgqgtqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2x1qB (B:)
    qvqlqesggglvqpggslrlscaasgrtfsnyrmgwfrqapgkerefvatisqsgaatay
    adsvkgrftfsrdnaknllylemlslepedtavyycaassrvfytevlqtttgydywgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1qB (B:)
    qlqesggglvqpggslrlscaafsnyrmgwfrqapgkerefvatisqsgaatayadsvkg
    rftfsrdnaknllylemlslepedtavyycaassrvfytevlqtttgydywgqgtqvtvs
    s