PDB entry 2x1f

View 2x1f on RCSB PDB site
Description: structure of rna15 rrm with bound RNA (gu)
Class: transcription/RNA
Keywords: transcription-RNA complex, mRNA processing
Deposited on 2010-01-06, released 2010-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2104
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA 3'-end-processing protein rna15
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25299 (0-87)
    • PDB 2X1F (88-End)
    Domains in SCOPe 2.07: d2x1fa1, d2x1fa2
  • Chain 'B':
    Compound: 5'-r(*gp*up*up*gp*up)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x1fA (A:)
    psrvvylgsipydqteeqildlcsnvgpvinlkmmfdpqtgrskgyafiefrdlessasa
    vrnlngyqlgsrflkcgyssnsdisgvslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1fA (A:)
    psrvvylgsipydqteeqildlcsnvgpvinlkmmfdpqtgrskgyafiefrdlessasa
    vrnlngyqlgsrflkcgyssnsdisgvslehhhh
    

  • Chain 'B':
    No sequence available.