PDB entry 2x1b

View 2x1b on RCSB PDB site
Description: structure of rna15 rrm
Class: transcription
Keywords: transcription, nucleus, RNA-binding, mRNA processing
Deposited on 2010-01-06, released 2010-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18499
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA 3'-end-processing protein rna15
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2X1B (0-0)
    • Uniprot P25299 (1-End)
    Domains in SCOPe 2.07: d2x1ba_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2x1bA (A:)
    gpsrvvylgsipydqteeqildlcsnvgpvinlkmmfdpqtgrskgyafiefrdlessas
    avrnlngyqlgsrflkcgyssnsdisgvsqqqqqqyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2x1bA (A:)
    gpsrvvylgsipydqteeqildlcsnvgpvinlkmmfdpqtgrskgyafiefrdlessas
    avrnlngyqlgsrflkcgyssnsdisg