PDB entry 2x0j

View 2x0j on RCSB PDB site
Description: 2.8 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with etheno-nad
Class: oxidoreductase
Keywords: oxidoreductase, hyperthermophilic, tricarboxylic acid cycle
Deposited on 2009-12-14, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Archaeoglobus fulgidus DSM 4304 [TaxId:224325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2x0ja1, d2x0ja2
  • Heterogens: ENA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2x0jA (A:)
    mklgfvgagrvgstsaftcllnldvdeialvdiaedlavgeamdlahaaagidkypkivg
    gadysllkgseiivvtaglarkpgmtrldlahknagiikdiakkivenapeskilvvtnp
    mdvmtyimwkesgkprnevfgmgnqldsqrlkerlynagarnirrawiigehgdsmfvak
    sladfdgevdweavendvrfvaaevikrkgatifgpavaiyrmvkavvedtgeiiptsmi
    lqgeygienvavgvpaklgkngaevadiklsdeeieklrnsakilrerleelgy