PDB entry 2wy3

View 2wy3 on RCSB PDB site
Description: Structure of the HCMV UL16-MICB complex elucidates select binding of a viral immunoevasin to diverse NKG2D ligands
Class: immune system/viral protein
Keywords: immune system-viral protein complex, immune response, innate immunity, structural mimicry, immunoglobulin domain, membrane, cytolysis, ulbp, nkg2d, nk cell, cell membrane, transmembrane, viral immune evasion, natural killer cell, convergent evolution
Deposited on 2009-11-11, released 2010-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1788
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I polypeptide-related sequence b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WY3 (0-0)
      • conflict (57)
      • conflict (113)
    • Uniprot Q29980 (1-End)
    Domains in SCOPe 2.07: d2wy3a_
  • Chain 'B':
    Compound: uncharacterized protein ul16
    Species: HUMAN HERPESVIRUS 5 STRAIN AD169 [TaxId:10360]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: MHC class I polypeptide-related sequence b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WY3
      • conflict (57)
      • conflict (113)
    • Uniprot Q29980 (1-End)
    Domains in SCOPe 2.07: d2wy3c_
  • Chain 'D':
    Compound: uncharacterized protein ul16
    Species: HUMAN HERPESVIRUS 5 STRAIN AD169 [TaxId:10360]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PEU, ACT, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wy3A (A:)
    mephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw
    dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls
    qnletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksgvair
    rtvppmvnvtcsevsegnitvtcrassfyprnitltwrqdgvslshntqqwgdvlpdgng
    tyqtwvatrirqgeeqrftcymehsgnhgthpvpsgkvlvlqsqrtdfpyvsaampcfvi
    iiilcvpcckkktsaaegp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wy3A (A:)
    mephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw
    dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls
    qnletqestvpqssraqtlamnvtnfwkektkthyramqadclqklqrylksg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wy3C (C:)
    mephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw
    dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls
    qnletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksgvair
    rtvppmvnvtcsevsegnitvtcrassfyprnitltwrqdgvslshntqqwgdvlpdgng
    tyqtwvatrirqgeeqrftcymehsgnhgthpvpsgkvlvlqsqrtdfpyvsaampcfvi
    iiilcvpcckkktsaaegp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wy3C (C:)
    ephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetwd
    tetedltengqdlrrtlthilhslqeirvceihedsstrgsrhfyyngelflsqnletqe
    stvpqssraqtlamnvtnfwkamktkthyramqadclqklqrylksg
    

  • Chain 'D':
    No sequence available.