PDB entry 2wx5

View 2wx5 on RCSB PDB site
Description: hexa-coordination of a bacteriochlorophyll cofactor in the rhodobacter sphaeroides reaction centre
Class: photosynthesis
Keywords: photosynthesis, reaction center, membrane protein, photosynthetic reaction center, electron transport, bacteriochlorophyll, iron, membrane, magnesium, transport, chromophore, chlorophyll, metal-binding, transmembrane
Deposited on 2009-11-02, released 2010-02-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: 0.23941
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: reaction center protein h chain
    Species: RHODOBACTER SPHAEROIDES [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wx5h1, d2wx5h2
  • Chain 'L':
    Compound: reaction centre protein l chain
    Species: RHODOBACTER SPHAEROIDES [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0Y8 (0-280)
      • engineered mutation (180)
    Domains in SCOPe 2.06: d2wx5l_
  • Chain 'M':
    Compound: reaction centre protein m chain
    Species: RHODOBACTER SPHAEROIDES [TaxId:1063]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wx5m_
  • Heterogens: LDA, NA, BCL, GOL, HTO, BPH, CDL, FE, SPN, U10, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2wx5H (H:)
    mvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wx5H (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wx5L (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    rtnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2wx5M (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wx5M (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hg