PDB entry 2wvh

View 2wvh on RCSB PDB site
Description: structural insights into the pre-reaction state of pyruvate decarboxylase from zymomonas mobilis
Class: lyase
Keywords: thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation
Deposited on 2009-10-16, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.172
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wvha1, d2wvha2, d2wvha3
  • Chain 'B':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wvhb1, d2wvhb2, d2wvhb3
  • Chain 'E':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wvhe1, d2wvhe2, d2wvhe3
  • Chain 'F':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wvhf1, d2wvhf2, d2wvhf3
  • Chain 'V':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wvhv1, d2wvhv2, d2wvhv3
  • Chain 'X':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wvhx1, d2wvhx2, d2wvhx3
  • Chain 'Y':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wvhy1, d2wvhy2, d2wvhy3
  • Chain 'Z':
    Compound: pyruvate decarboxylase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wvhz1, d2wvhz2, d2wvhz3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wvhA (A:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvhA (A:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wvhB (B:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvhB (B:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wvhE (E:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvhE (E:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wvhF (F:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvhF (F:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2wvhV (V:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvhV (V:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2wvhX (X:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvhX (X:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvn
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2wvhY (Y:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvhY (Y:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2wvhZ (Z:)
    msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
    arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
    yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
    asalfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggav
    atmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
    pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapad
    psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
    aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
    ynniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfig
    redcteelvkwgkrvaaansrkpvnkll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wvhZ (Z:)
    sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
    rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
    hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
    salfndeasdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggava
    tmaaaksffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdp
    kklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadp
    saplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpa
    afgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpy
    nniknwdyaglmevfngnggydsgagkglkaktggelaeaikvalantdgptliecfigr
    edcteelvkwgkrvaaansrkpvnk