PDB entry 2wuh

View 2wuh on RCSB PDB site
Description: crystal structure of the ddr2 discoidin domain bound to a triple-helical collagen peptide
Class: receptor/peptide
Keywords: receptor-peptide complex, transferase, nucleotide-binding, tyrosine-protein kinase
Deposited on 2009-10-05, released 2009-12-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2019
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: discoidin domain receptor 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WUH
  • Uniprot Q16832 (13-End)
  Domains in SCOPe 2.05: d2wuha_
• Chain 'B':
  Compound: collagen peptide
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WUH (Start-27)
• Chain 'C':
  Compound: collagen peptide
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WUH (Start-27)
• Chain 'D':
  Compound: collagen peptide
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WUH
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2wuhA (A:)
  aplvhhhhhhalanpaicryplgmsggqipdeditassqwsestaakygrldseegdgaw
  cpeipvepddlkeflqidlhtlhfitlvgtqgrhagghgiefapmykinysrdgtrwisw
  rnrhgkqvldgnsnpydiflkdleppivarfvrfipvtdhsmnvcmrvelygcvwldg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2wuhA (A:)
  npaicryplgmsggqipdeditassqwsestaakygrldseegdgawcpeipvepddlke
  flqidlhtlhfitlvgtqgrhagghgiefapmykinysrdgtrwiswrnrhgkqvldgns
  npydiflkdleppivarfvrfipvtdhsmnvcmrvelygcvwld
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.