PDB entry 2wuf

View 2wuf on RCSB PDB site
Description: crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with 4,9dsha
Class: hydrolase
Keywords: hydrolase
Deposited on 2009-10-02, released 2009-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase bphd
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96851
      • engineered mutation (113)
    Domains in SCOPe 2.06: d2wufa_
  • Chain 'B':
    Compound: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase bphd
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96851
      • engineered mutation (113)
    Domains in SCOPe 2.06: d2wufb_
  • Heterogens: GOL, SCN, KEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wufA (A:)
    mtateeltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrnia
    vlarhfhvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnalgggta
    vrfaldyparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvyd
    knlitpelvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgre
    drvnpldgalvalktipraqlhvfgqcghwvqvekfdefnkltieflgggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wufA (A:)
    ltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrniavlarhf
    hvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnalgggtavrfald
    yparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvydknlitp
    elvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgredrvnpl
    dgalvalktipraqlhvfgqcghwvqvekfdefnkltieflg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wufB (B:)
    mtateeltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrnia
    vlarhfhvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnalgggta
    vrfaldyparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvyd
    knlitpelvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgre
    drvnpldgalvalktipraqlhvfgqcghwvqvekfdefnkltieflgggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wufB (B:)
    ltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrniavlarhf
    hvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnalgggtavrfald
    yparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvydknlitp
    elvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgredrvnpl
    dgalvalktipraqlhvfgqcghwvqvekfdefnkltieflg