PDB entry 2wtr

View 2wtr on RCSB PDB site
Description: full length arrestin2
Class: signaling protein
Keywords: signaling protein, sensory transduction, g-protein-coupled receptor desensitization, phosphoprotein
Deposited on 2009-09-21, released 2009-09-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2508
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-arrestin-1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wtra1, d2wtra2
  • Chain 'B':
    Compound: beta-arrestin-1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17870
      • conflict (70)
    Domains in SCOPe 2.06: d2wtrb1, d2wtrb2
  • Heterogens: BA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wtrA (A:)
    mgdkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltca
    frygredldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeip
    pnlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgp
    qptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyad
    iclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnl
    asstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpkpkeep
    phrevpehetpvdtnlieldtndddivfedfarqrlkgmkddkeeeedgtgsprlndr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtrA (A:)
    kgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafry
    gredldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnl
    pcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpqptae
    ttrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclfn
    taqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnlasstl
    lreganreilgiivsykvkvklvvssdvavelpftlmhpkpkddivfedfarqrlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wtrB (B:)
    mgdkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltca
    frygredldvvgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeip
    pnlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgp
    qptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyad
    iclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnl
    asstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpkpkeep
    phrevpehetpvdtnlieldtndddivfedfarqrlkgmkddkeeeedgtgsprlndr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtrB (B:)
    gdkgtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcaf
    rygrvgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpcs
    vtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpqptaettr
    qflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclfntaq
    ykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnlasstllre
    ganreilgiivsykvkvklvvsrassdvavelpftlmhpkpkeepldtndddivfedfar
    qrlkgmk