PDB entry 2wtl

View 2wtl on RCSB PDB site
Description: crystal structure of bfra from m. tuberculosis
Class: metal binding protein
Keywords: metal binding protein, bacterioferritin a, heme, iron, biliverdin, iron storage, metal-binding
Deposited on 2009-09-17, released 2009-12-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-12-15, with a file datestamp of 2009-12-11.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.1849
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WTL (163-End)
    • Uniprot P63697 (Start-162)
    Domains in SCOPe 2.04: d2wtla_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WTL (163-End)
    • Uniprot P63697 (Start-162)
    Domains in SCOPe 2.04: d2wtlb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WTL (163-End)
    • Uniprot P63697 (Start-162)
    Domains in SCOPe 2.04: d2wtlc_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WTL (163-End)
    • Uniprot P63697 (Start-162)
    Domains in SCOPe 2.04: d2wtld_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WTL (163-End)
    • Uniprot P63697 (Start-162)
    Domains in SCOPe 2.04: d2wtle_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WTL (163-End)
    • Uniprot P63697 (Start-162)
    Domains in SCOPe 2.04: d2wtlf_
  • Heterogens: FE, UNX, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wtlA (A:)
    asgsmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhae
    eitdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdtts
    avllekivadeeehidyletqlelmdklgeelysaqcvsrpptsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtlA (A:)
    qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
    illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
    kivadeeehidyletqlelmdklgeelysaqcvsrpptsaw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wtlB (B:)
    asgsmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhae
    eitdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdtts
    avllekivadeeehidyletqlelmdklgeelysaqcvsrpptsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtlB (B:)
    qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
    illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
    kivadeeehidyletqlelmdklgeelysaqcvsrpptsaw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wtlC (C:)
    asgsmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhae
    eitdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdtts
    avllekivadeeehidyletqlelmdklgeelysaqcvsrpptsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtlC (C:)
    qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
    illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
    kivadeeehidyletqlelmdklgeelysaqcvsrpptsaw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wtlD (D:)
    asgsmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhae
    eitdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdtts
    avllekivadeeehidyletqlelmdklgeelysaqcvsrpptsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtlD (D:)
    qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
    illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
    kivadeeehidyletqlelmdklgeelysaqcvsrpptsaw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wtlE (E:)
    asgsmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhae
    eitdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdtts
    avllekivadeeehidyletqlelmdklgeelysaqcvsrpptsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtlE (E:)
    qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
    illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
    kivadeeehidyletqlelmdklgeelysaqcvsrpptsaw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wtlF (F:)
    asgsmqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhae
    eitdrillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdtts
    avllekivadeeehidyletqlelmdklgeelysaqcvsrpptsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wtlF (F:)
    qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
    illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
    kivadeeehidyletqlelmdklgeelysaqcvsrpptsaw