PDB entry 2wqw

View 2wqw on RCSB PDB site
Description: double-disulfide cross-linked crystal dimer of the listeria monocytogenes inlb internalin domain
Class: cell invasion
Keywords: hgf receptor ligand, leucine-rich repeat, leucine rich repeat, lrr, c-met ligand, cell invasion, virulence factor
Deposited on 2009-08-27, released 2009-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.201
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25147 (0-285)
      • engineered mutation (170)
      • engineered mutation (191)
      • engineered mutation (206)
    Domains in SCOPe 2.06: d2wqwa1, d2wqwa2
  • Chain 'B':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25147 (0-285)
      • engineered mutation (170)
      • engineered mutation (191)
      • engineered mutation (206)
    Domains in SCOPe 2.06: d2wqwb1, d2wqwb2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wqwA (A:)
    etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngis
    dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplacltklqnlyl
    sknhisdlralcglknldvlelfsqealnkpinhqsnlvvpntvkntdgslvtpeiisdd
    gdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wqwB (B:)
    etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngis
    dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplacltklqnlyl
    sknhisdlralcglknldvlelfsqealnkpinhqsnlvvpntvkntdgslvtpeiisdd
    gdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke