PDB entry 2wqv

View 2wqv on RCSB PDB site
Description: internalin domain of listeria monocytogenes inlb: rhombohedral crystal form
Class: cell invasion
Keywords: hgf receptor ligand, leucine-rich repeat, lrr, c-met ligand, cell invasion, virulence factor
Deposited on 2009-08-27, released 2009-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.205
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wqva1, d2wqva2
  • Chain 'B':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wqvb1, d2wqvb2
  • Heterogens: PG4, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wqvA (A:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehn
    gisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqn
    lylsknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeii
    sddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqvA (A:)
    titvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiqy
    lpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngisd
    inglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyls
    knhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeiisddg
    dyekpnvkwhlnevsfifyqpvtigkakarfhgrvtqplk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wqvB (B:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehn
    gisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqn
    lylsknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeii
    sddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqvB (B:)
    titvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiqy
    lpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngisd
    inglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyls
    knhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeiisddg
    dyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplk