PDB entry 2wqu

View 2wqu on RCSB PDB site
Description: internalin domain of listeria monocytogenes inlb: triclinic crystal form
Class: cell invasion
Keywords: hgf receptor ligand, leucine rich repeat, lrr, c-met ligand, cell invasion, virulence factor
Deposited on 2009-08-27, released 2009-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.194
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQU
    • Uniprot P25147 (3-End)
    Domains in SCOPe 2.06: d2wqua1, d2wqua2
  • Chain 'B':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQU
    • Uniprot P25147 (3-End)
    Domains in SCOPe 2.06: d2wqub1, d2wqub2
  • Chain 'C':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQU
    • Uniprot P25147 (3-End)
    Domains in SCOPe 2.06: d2wquc1, d2wquc2
  • Chain 'D':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQU
    • Uniprot P25147 (Start-288)
    Domains in SCOPe 2.06: d2wqud1, d2wqud2
  • Chain 'E':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wque1, d2wque2
  • Chain 'F':
    Compound: internalin b
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wquf1, d2wquf2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wquA (A:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehn
    gisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqn
    lylsknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeii
    sddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wquA (A:)
    etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngis
    dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
    sknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeiisdd
    gdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wquB (B:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehn
    gisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqn
    lylsknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeii
    sddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wquB (B:)
    etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngis
    dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
    sknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeiisdd
    gdyekpnvkwhnevsfifyqpvtigkakarfhgrvtqplk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wquC (C:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehn
    gisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqn
    lylsknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeii
    sddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wquC (C:)
    etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngis
    dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
    sknhisdlralaglknldvlelfsqeclnkpipntvkntdgslvtpeiisddgdyekpnv
    sfifyqpvtigkakarfhgrvtqp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wquD (D:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehn
    gisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqn
    lylsknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeii
    sddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wquD (D:)
    titvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiqy
    lpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngisd
    inglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyls
    knhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeiisddg
    dyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wquE (E:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehn
    gisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqn
    lylsknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeii
    sddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wquE (E:)
    titvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiqy
    lpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngisd
    inglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyls
    knhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeiisddg
    dyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wquF (F:)
    gametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvq
    giqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehn
    gisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqn
    lylsknhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeii
    sddgdyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wquF (F:)
    titvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiqy
    lpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngisd
    inglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyls
    knhisdlralaglknldvlelfsqeclnkpinhqsnlvvpntvkntdgslvtpeiisddg
    dyekpnvkwhlpeftnevsfifyqpvtigkakarfhgrvtqplk