PDB entry 2wqt

View 2wqt on RCSB PDB site
Description: dodecahedral assembly of mhpd
Class: lyase
Keywords: lyase, hydratase, dodecahedral form, aromatic hydrocarbons catabolism
Deposited on 2009-08-27, released 2010-01-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22253
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqta_
  • Chain 'B':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtb_
  • Chain 'C':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtc_
  • Chain 'D':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtd_
  • Chain 'E':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqte_
  • Chain 'F':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtf_
  • Chain 'G':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtg_
  • Chain 'H':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqth_
  • Chain 'I':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqti_
  • Chain 'J':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtj_
  • Chain 'K':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtk_
  • Chain 'L':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtl_
  • Chain 'M':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtm_
  • Chain 'N':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtn_
  • Chain 'O':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqto_
  • Chain 'P':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtp_
  • Chain 'Q':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtq_
  • Chain 'R':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtr_
  • Chain 'S':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqts_
  • Chain 'T':
    Compound: 2-keto-4-pentenoate hydratase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WQT (0-0)
    • Uniprot P77608 (1-End)
    Domains in SCOPe 2.01: d2wqtt_
  • Heterogens: PO4, NA, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wqtA (A:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtA (A:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wqtB (B:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtB (B:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wqtC (C:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtC (C:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wqtD (D:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtD (D:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wqtE (E:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtE (E:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wqtF (F:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtF (F:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2wqtG (G:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtG (G:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2wqtH (H:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtH (H:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2wqtI (I:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtI (I:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2wqtJ (J:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtJ (J:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2wqtK (K:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtK (K:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2wqtL (L:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtL (L:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2wqtM (M:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtM (M:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2wqtN (N:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtN (N:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2wqtO (O:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtO (O:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2wqtP (P:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtP (P:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2wqtQ (Q:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtQ (Q:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2wqtR (R:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtR (R:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2wqtS (S:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtS (S:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2wqtT (T:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfssaapkgsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqtT (T:)
    lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
    kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
    ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
    ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
    nagdrfeahiegigsvaatfss