PDB entry 2wqe

View 2wqe on RCSB PDB site
Description: structure of s155r aurora-a somatic mutant
Class: transferase
Keywords: polymorphism, phosphoprotein, nucleotide-binding, cell cycle, transferase
Deposited on 2009-08-20, released 2009-09-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-12-08, with a file datestamp of 2009-12-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2062
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965 (0-261)
      • engineered mutation (28)
    Domains in SCOPe 2.03: d2wqea_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wqeA (A:)
    qwaledfeigrplgkgkfgnvylarekqrkfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmh
    dekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkh
    npsqrpmlrevlehpwitanss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wqeA (A:)
    qwaledfeigrplgkgkfgnvylarekqrkfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadgtldylppemidekvdlwslgvlcyeflvgkp
    pfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwitans
    s