PDB entry 2wq8

View 2wq8 on RCSB PDB site
Description: glycan labelling using engineered variants of galactose oxidase obtained by directed evolution
Class: oxidoreductase
Keywords: oxidoreductase, kelch repeat, metal-binding, glycoengineering, directed evolution
Deposited on 2009-08-14, released 2010-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.18515
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose oxidase
    Species: GIBBERELLA ZEAE [TaxId:5518]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01745 (22-660)
      • engineered mutation (31)
      • engineered mutation (91)
      • engineered mutation (216)
      • engineered mutation (311)
      • engineered mutation (351)
      • engineered mutation (427)
      • engineered mutation (484)
      • engineered mutation (515)
      • engineered mutation (556)
    Domains in SCOPe 2.07: d2wq8a1, d2wq8a2, d2wq8a3
  • Heterogens: CU, CA, ACY, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wq8A (A:)
    mghhhhhhhhhhssghiegrhmasapigsaiprnnwavtcdsaqsgnecnkaidgnkdtf
    whtfygangdpkpphtytidmkttqnvnglsvlprqdgnqngwigrhevylssdgtnwgs
    pvasgswfadsttkysnfetrparyvrlvaiteangqpwtsiaeinvfqassytapqpgl
    grwgptidlpivpaaaaieptsgrvlmwssyrndafegspggitltsswdpstgivsdrt
    vtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvargyqssatm
    sdgrvftiggsfsggvfekngevyspssktwtslpnakvnpmltadkqglyksdnhawlf
    gwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmydavkgkilt
    fggspdytdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdgstfitggq
    rrgiifedstpvftpeiyvpeqdtfykqnpnsivrayhsislllpdgrvfngggglcgdc
    ttnhfdaqiftpnylydsngnlatrpkitrtstqsvkvggritistdssiskaslirygt
    athtvntdqrripltltnnggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvt
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wq8A (A:)
    asapigsaiprnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
    ttqnvnglsvlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
    aryvrlvaiteangqpwtsiaeinvfqassytapqpglgrwgptidlpivpaaaaiepts
    grvlmwssyrndafegspggitltsswdpstgivsdrtvtvtkhdmfcpgismdgngqiv
    vtggndakktslydsssdswipgpdmqvargyqssatmsdgrvftiggsfsggvfeknge
    vyspssktwtslpnakvnpmltadkqglyksdnhawlfgwkkgsvfqagpstamnwyyts
    gsgdvksagkrqsnrgvapdamcgnavmydavkgkiltfggspdytdsdattnahiitlg
    epgtspntvfasnglyfartfhtsvvlpdgstfitggqrrgiifedstpvftpeiyvpeq
    dtfykqnpnsivrayhsislllpdgrvfngggglcgdcttnhfdaqiftpnylydsngnl
    atrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnnggn
    sysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq