PDB entry 2wph
View 2wph on RCSB PDB site
Description: factor IXa superactive triple mutant
Class: blood clotting
Keywords: blood clotting, hydrolase, glycoprotein, hemostasis
Deposited on
2009-08-06, released
2009-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-07-05, with a file datestamp of
2017-06-30.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'E':
Compound: Coagulation factor IXa light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2wphe_ - Chain 'L':
Compound: d-phe-pro-arg-chloromethyl ketone
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- Chain 'S':
Compound: Coagulation factor IXa heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P00740 (0-234)
- engineered mutation (78)
- engineered mutation (82)
- engineered mutation (164)
Domains in SCOPe 2.07: d2wphs_ - Heterogens: CA, 1PE, HOH
PDB Chain Sequences:
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>2wphE (E:)
tcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtskltr
- Chain 'L':
No sequence available.
- Chain 'S':
Sequence; same for both SEQRES and ATOM records: (download)
>2wphS (S:)
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnfnaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt