PDB entry 2wp8

View 2wp8 on RCSB PDB site
Description: yeast rrp44 nuclease
Class: hydrolase
Keywords: exosome, nucleus, nuclease, hydrolase, RNA-binding, exonuclease, RNA binding, mitochondrion, rRNA processing
Deposited on 2009-08-03, released 2009-11-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.20899
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exosome complex component rrp45
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: exosome complex component ski6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46948
      • conflict (78)
    Domains in SCOPe 2.04: d2wp8b1, d2wp8b2
  • Chain 'J':
    Compound: exosome complex exonuclease dis3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08162 (Start-976)
      • engineered mutation (526)
  • Heterogens: CL, GOL

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wp8B (B:)
    msrleiyspeglrldgrrwnelrrfessinthphaadgssymeqgnnkiitlvkgpkepr
    lksqmdtskallnvsvninkfskfersksshknerrvleiqtslvrmfeknvmlniyprt
    vidieihvleqdggimgslingitlalidagismfdyisgisvglydttplldtnsleen
    amstvtlgvvgkseklslllvedkipldrlenvlaigiagahrvrdlmdeelrkhaqkrv
    snasar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wp8B (B:)
    rleiyspeglrldgrrwnelrrfessinthphaadgssymeqgnnkiitlvkgpkemdts
    kallnvsvninerrvleiqtslvrmfeknvmlniyprtvidieihvleqdggimgsling
    itlalidagismfdyisgisvglydttplldtnsleenamstvtlgvvgkseklslllve
    dkipldrlenvlaigiagahrvrdlmdeelrkhaqkr
    

  • Chain 'J':
    No sequence available.