PDB entry 2wox

View 2wox on RCSB PDB site
Description: betaine aldehyde dehydrogenase from pseudomonas aeruginosa with nad(p)h-catalytic thiol adduct.
Class: oxidoreductase
Keywords: oxidoreductase, aldehyde oxidation, nadph complex
Deposited on 2009-07-30, released 2010-08-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.1635
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2woxa_
  • Chain 'B':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2woxb_
  • Chain 'C':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2woxc_
  • Chain 'D':
    Compound: betaine aldehyde dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2woxd_
  • Heterogens: NDP, K, GOL, 7PE, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2woxA (A:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2woxB (B:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2woxC (C:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2woxD (D:)
    arfeeqklyiggryveassgatfetinpangevlakvqrasredveravqsavegqkvwa
    amtamqrsrilrravdilrerndelaaletldtgkplaetrsvdivtgadvleyyaglvp
    aiegeqiplretsfvytrreplgvvagigawnypvqialwksapalaagnamifkpsevt
    pltalklaeiyteagvpdgvfnvltgsgrevgqwltehpliekisftggtstgkkvmasa
    sssslkevtmelggkspliifpdadldraadiavmanffssgqvctngtrvfihrsqqar
    feakvlervqrirlgdpqdentnfgplvsfphmesvlgyiesgkaqkarllcggervtdg
    afgkgayvaptvftdcrddmtivreeifgpvmsilvyddedeairrandteyglaagvvt
    qdlarahraihrleagicwintwgespaempvggykqsgvgrenglttlahytriksvqv
    elgdyasvf