PDB entry 2wou

View 2wou on RCSB PDB site
Description: alk5 in complex with 4-((4-((2,6-dimethyl-3-pyridyl)oxy)-2-pyridyl)amino)benzenesulfonamide
Class: transferase
Keywords: transferase, serine/threonine-protein kinase, alk, ATP-binding, kinase inhibitor, nucleotide-binding, tgf beta type I receptor
Deposited on 2009-07-28, released 2009-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22929
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2WOU (0-1)
    • Uniprot P36897 (2-End)
    Domains in SCOPe 2.07: d2woua1, d2woua2
  • Heterogens: EDO, ZZF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wouA (A:)
    ggtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhe
    nilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlh
    meivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkr
    ymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdps
    veemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsq
    qegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wouA (A:)
    ggtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhe
    nilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlh
    meivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkr
    ymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdps
    veemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqls