PDB entry 2wot

View 2wot on RCSB PDB site
Description: ALK5 IN COMPLEX WITH 4-((5,6-dimethyl-2-(2-pyridyl)-3-pyridyl)oxy)-N-(3,4,5-trimethoxyphenyl)pyridin-2-amine
Class: transferase
Keywords: alk5, kinase, membrane, receptor, manganese, serine/threonine-protein kinase, kinase inhibitor, disease mutation, craniosynostosis, nucleotide-binding, tgf beta type I receptor, phosphoprotein, disulfide bond, aortic aneurysm, glycoprotein, metal-binding, transmembrane, ATP-binding, transferase
Deposited on 2009-07-28, released 2009-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.18098
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2WOT (0-1)
    • Uniprot P36897 (2-End)
    Domains in SCOPe 2.07: d2wota1, d2wota2
  • Heterogens: ZZG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wotA (A:)
    ggtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhe
    nilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlh
    meivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkr
    ymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdps
    veemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsq
    qegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wotA (A:)
    ggtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhe
    nilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlh
    meivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkr
    ymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdps
    veemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsq
    qeg