PDB entry 2wnr

View 2wnr on RCSB PDB site
Description: The structure of Methanothermobacter thermautotrophicus exosome core assembly
Class: hydrolase
Keywords: phosphate binding, 3'-5' exoribonuclease, exosome, nuclease, hydrolase, exonuclease
Deposited on 2009-07-19, released 2010-04-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.21218
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable exosome complex exonuclease 2
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2wnra1, d2wnra2
  • Chain 'B':
    Compound: probable exosome complex exonuclease 1
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2wnrb1, d2wnrb2
  • Chain 'C':
    Compound: probable exosome complex exonuclease 2
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2wnrc1, d2wnrc2
  • Chain 'D':
    Compound: probable exosome complex exonuclease 1
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2wnrd1, d2wnrd2
  • Chain 'E':
    Compound: probable exosome complex exonuclease 2
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2wnre1, d2wnre2
  • Chain 'F':
    Compound: probable exosome complex exonuclease 1
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2wnrf1, d2wnrf2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wnrA (A:)
    mvnkmdiipeitrksitdlinnkeridgrslhefrdisietgviskaegssrvklgntqi
    ivgvkpqigepfpdtpemgviltnsellpmasptfepgppdersvelsrvvdrciresrm
    idleklciiegskvwmlfldlhiidydgnlfdaavlatvaalldtripaaevedgevvin
    rekmqplpvnrkalmctfakigneivldpsleeediltarisigvteegsicamqkggeg
    pltrddvlkavsiavekvpqlieyldksmtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnrA (A:)
    peitrksitdlinnkeridgrslhefrdisietgviskaegssrvklgntqiivgvkpqi
    gepfpdtpemgviltnsellpmasptfepgppdersvelsrvvdrciresrmidleklci
    iegskvwmlfldlhiidydgnlfdaavlatvaalldtripaaevedgevvinrekmqplp
    vnrkalmctfakigneivldpsleeediltarisigvteegsicamqkggegpltrddvl
    kavsiavekvpqlieyldksm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wnrB (B:)
    mitiitqdqlktspsvredgrafdelrplkieagileradgssylefggnkilvavygpr
    eaqirklqrpdravircrynmapfsveerkrpgpdrrsveiskitaealrpalilekfpr
    svidvfievleaeggtrcagitaasvaladagipmrdmvvacaagkvgdqvvldlseeed
    kegqadvpvailprtreitllqsdgnltpeeferaldlavegclrihevqkealrkryge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnrB (B:)
    svredgrafdelrplkieagileradgssylefggnkilvavygpreaqirklqrpdrav
    ircrynmapfsveerkrpgpdrrsveiskitaealrpalilekfprsvidvfievleaeg
    gtrcagitaasvaladagipmrdmvvacaagkvgdqvvldlseeedkegqadvpvailpr
    treitllqsdgnltpeeferaldlavegclrihevqkealrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wnrC (C:)
    mvnkmdiipeitrksitdlinnkeridgrslhefrdisietgviskaegssrvklgntqi
    ivgvkpqigepfpdtpemgviltnsellpmasptfepgppdersvelsrvvdrciresrm
    idleklciiegskvwmlfldlhiidydgnlfdaavlatvaalldtripaaevedgevvin
    rekmqplpvnrkalmctfakigneivldpsleeediltarisigvteegsicamqkggeg
    pltrddvlkavsiavekvpqlieyldksmtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnrC (C:)
    rksitdlinnkeridgrslhefrdisietgviskaegssrvklgntqiivgvkpqigepf
    pdtpemgviltnsellpmasptfepgppdersvelsrvvdrciresrmidleklciiegs
    kvwmlfldlhiidydgnlfdaavlatvaalldtripaaevedgevvinrekmqplpvnrk
    almctfakigneivldpsleeediltarisigvteegsicamqkggegpltrddvlkavs
    iavekvpqlieyldksmt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wnrD (D:)
    mitiitqdqlktspsvredgrafdelrplkieagileradgssylefggnkilvavygpr
    eaqirklqrpdravircrynmapfsveerkrpgpdrrsveiskitaealrpalilekfpr
    svidvfievleaeggtrcagitaasvaladagipmrdmvvacaagkvgdqvvldlseeed
    kegqadvpvailprtreitllqsdgnltpeeferaldlavegclrihevqkealrkryge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnrD (D:)
    vredgrafdelrplkieagileradgssylefggnkilvavygpreavircrynmapfsv
    eerkrpgpdrrsveiskitaealrpalilekfprsvidvfievleaeggtrcagitaasv
    aladagipmrdmvvacaagkvgdqvvldlseeedkegqadvpvailprtreitllqsdgn
    ltpeeferaldlavegclrihevqkealrk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wnrE (E:)
    mvnkmdiipeitrksitdlinnkeridgrslhefrdisietgviskaegssrvklgntqi
    ivgvkpqigepfpdtpemgviltnsellpmasptfepgppdersvelsrvvdrciresrm
    idleklciiegskvwmlfldlhiidydgnlfdaavlatvaalldtripaaevedgevvin
    rekmqplpvnrkalmctfakigneivldpsleeediltarisigvteegsicamqkggeg
    pltrddvlkavsiavekvpqlieyldksmtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnrE (E:)
    nnkeridgrslhefrdisietgviskaegssrvklgntqiivgvkpqigepfpdtpemgv
    iltnsellpmasptfepgppdersvelsrvvdrciresrmidleklciiegskvwmlfld
    lhiidydgnlfdaavlatvaalldtripaaevedgevvinrekmqplpvnrkalmctfak
    igneivldpsleeediltarisigvteegsicamqkggegpltrddvlkavsiavekvpq
    lieyldksmt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wnrF (F:)
    mitiitqdqlktspsvredgrafdelrplkieagileradgssylefggnkilvavygpr
    eaqirklqrpdravircrynmapfsveerkrpgpdrrsveiskitaealrpalilekfpr
    svidvfievleaeggtrcagitaasvaladagipmrdmvvacaagkvgdqvvldlseeed
    kegqadvpvailprtreitllqsdgnltpeeferaldlavegclrihevqkealrkryge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnrF (F:)
    psvredgrafdelrplkieagileradgssylefggnkilvavygpreapdravircryn
    mapfsveerkrpgpdrrsveiskitaealrpalilekfprsvidvfievleaeggtrcag
    itaasvaladagipmrdmvvacaagkvgdqvvldlseeedkegqadvpvailprtreitl
    lqsdgnltpeeferaldlavegclrihevqkealrkr