PDB entry 2wlu

View 2wlu on RCSB PDB site
Description: iron-bound crystal structure of streptococcus pyogenes dpr
Class: oxidoreductase
Keywords: DNA-binding, oxidoreductase
Deposited on 2009-06-26, released 2009-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.14663
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dps-like peroxide resistance protein
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5XAZ8 (Start-174)
      • conflict (78)
    Domains in SCOPe 2.04: d2wlua_
  • Heterogens: NA, FE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wluA (A:)
    mtntlveniyasvthniskkeasknektkavlnqavadlsvaasivhqvhwymrgpgfly
    lhpkmdelldslnanldevserlitiggapystlaefskhskldeakgtydktvaqhlar
    lvevylylsslyqvglditdeegdagtndlftaakteaektiwmlqaergqgpal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wluA (A:)
    tlveniyasvthnsknektkavlnqavadlsvaasivhqvhwymrgpgflylhpkmdell
    dslnanldevserlitiggapystlaefskhskldeakgtydktvaqhlarlvevylyls
    slyqvglditdeegdagtndlftaakteaektiwmlqaergqgpal