PDB entry 2wla

View 2wla on RCSB PDB site
Description: streptococcus pyogenes dpr
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2009-06-23, released 2009-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.15443
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dps-like peroxide resistance protein
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CN02 (Start-174)
      • conflict (78)
    Domains in SCOPe 2.04: d2wlaa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wlaA (A:)
    mtntlveniyasvthniskkeasknektkavlnqavadlsvaasivhqvhwymrgpgfly
    lhpkmdelldslnanldevserlitiggapystlaefskhskldeakgtydktvaqhlar
    lvevylylsslyqvglditdeegdagtndlftaakteaektiwmlqaergqgpal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wlaA (A:)
    ntlveniyasvthnsknektkavlnqavadlsvaasivhqvhwymrgpgflylhpkmdel
    ldslnanldevserlitiggapystlaefskhskldeakgtydktvaqhlarlvevylyl
    sslyqvglditdeegdagtndlftaakteaektiwmlqaergqgpal