PDB entry 2wl1

View 2wl1 on RCSB PDB site
Description: pyrin pryspry domain
Class: signaling protein
Keywords: amyloidosis, polymorphism, cytoskeleton, actin-binding inflammatory response, metal-binding, signaling protein, disease mutation, pryspry
Deposited on 2009-06-19, released 2009-10-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.194
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2wl1a_
  • Heterogens: SCN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wl1A (A:)
    nvpeligaqahavnvildaetaypnlifsddlksvrlgnkwerlpdgpqrfdsciivlgs
    psflsgrrywevevgdktawilgacktsisrkgnmtlspengywvvimmkeneyqassvp
    ptrllikeppkrvgifvdyrvgsisfynvtarshiytfascsfsgplqpifspgtrdggk
    ntaplticpvg