PDB entry 2wk4

View 2wk4 on RCSB PDB site
Description: dimeric structure of d347g d348g mutant of the sapporovirus RNA dependent RNA polymerase
Class: hydrolase
Keywords: covalent protein-RNA linkage, nucleotidyltransferase, RNA replication, phosphorylation, RNA elongation, thiol protease, capsid protein, ATP-binding, helicase, protease, hydrolase
Deposited on 2009-06-05, released 2010-09-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: 0.20309
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease-polymerase p70
    Species: SAPPORO VIRUS [TaxId:95342]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q69014
      • engineered mutation (346-347)
    Domains in SCOPe 2.06: d2wk4a_
  • Chain 'B':
    Compound: protease-polymerase p70
    Species: SAPPORO VIRUS [TaxId:95342]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q69014 (0-End)
      • engineered mutation (346-347)
    Domains in SCOPe 2.06: d2wk4b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wk4A (A:)
    defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
    lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
    fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
    rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
    ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
    gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygggcmysvcpatasi
    fhtvlanltsyglkptaadksdaikptntpvflkrtftqtphgirallditsitrqfywl
    kanrtsdpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntn
    ydqalatynawfiggtvpdpvghtegthkivfeme
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wk4A (A:)
    qwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtemlvn
    glkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgpfvq
    glkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagkrrl
    lwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlycldy
    skwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglpsgmp
    ftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygggcmysvcpatasifht
    vlanltsyglkptaadksdaikptntpvflkrtftqtphgirallditsitrqfywlkan
    rtsdpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntnydq
    alatynawfiggtvpdpvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wk4B (B:)
    defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
    lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
    fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
    rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
    ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
    gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygggcmysvcpatasi
    fhtvlanltsyglkptaadksdaikptntpvflkrtftqtphgirallditsitrqfywl
    kanrtsdpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntn
    ydqalatynawfiggtvpdpvghtegthkivfeme
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wk4B (B:)
    defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
    lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
    fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
    rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
    ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
    gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygggcmysvcpatasi
    fhtvlanltsyglkptaadksdaikptntpvflkrtftqtphgirallditsitrqfywl
    kanrtsdpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntn
    ydqalatynawfiggtvpdpvg