PDB entry 2wjw

View 2wjw on RCSB PDB site
Description: crystal structure of the human ionotropic glutamate receptor glur2 atd region at 1.8 a resolution
Class: transport protein
Keywords: transport protein, postsynaptic cell membrane, glur2, synapse, membrane, receptor, palmitate, synaptic plasticity, alternative splicing, ion transport, cell junction, cell membrane, transmembrane, phosphoprotein, glutamate receptors, polymorphism, glycoprotein, ionic channel, transport, ion channel, RNA editing, lipoprotein
Deposited on 2009-06-01, released 2009-08-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1829
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wjwa_
  • Heterogens: NAG, CL, SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wjwA (A:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdemyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtttikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvvtltelpsgndtsgle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjwA (A:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdemyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtttikytsaltydavqvmteafrnlrkqrieigdc
    lanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngprkigyws
    evdkmvvt