PDB entry 2wjn

View 2wjn on RCSB PDB site
Description: Lipidic sponge phase crystal structure of photosynthetic reaction centre from Blastochloris viridis (high dose)
Class: photosynthesis
Keywords: bacteriochlorophyll, lipidic-sponge phase, photosynthesis, reaction center, electron transport, cell membrane, metal-binding, transmembrane, formylation, chromophore, chlorophyll, lipoprotein, iron, heme, lipids, membrane, transport, magnesium
Deposited on 2009-05-27, released 2009-09-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.17185
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Photosynthetic reaction center cytochrome c subunit
    Species: RHODOPSEUDOMONAS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2wjnc_
  • Chain 'H':
    Compound: reaction center protein h chain
    Species: RHODOPSEUDOMONAS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: RHODOPSEUDOMONAS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2wjnl_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: RHODOPSEUDOMONAS VIRIDIS [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2wjnm_
  • Heterogens: HEM, BCB, BPB, MPG, FE2, MQ7, NS5, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wjnC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpikaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjnC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpik
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2wjnL (L:)
    mallsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptw
    dpfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpl
    afcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsf
    lfvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasn
    ifltgafgtiasgpfwtrgwpewwgwwldipfws
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjnL (L:)
    allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
    pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
    fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
    fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
    fltgafgtiasgpfwtrgwpewwgwwldipfws
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2wjnM (M:)
    madyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaaf
    afgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglf
    mtlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwp
    hidwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdr
    gtaveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkh
    gaapdypaylpatpdpaslpgapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjnM (M:)
    adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
    fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
    tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
    idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
    taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
    aapdypaylpatpdpaslpgapk