PDB entry 2wil

View 2wil on RCSB PDB site
Description: aged form of human butyrylcholinesterase inhibited by tabun analogue ta5
Class: hydrolase
Keywords: aging, hydrolase, inhibition, glycoprotein, serine esterase, disease mutation
Deposited on 2009-05-12, released 2009-05-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.2212
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholinesterase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06276 (Start-528)
      • engineered mutation (16)
      • engineered mutation (480)
    Domains in SCOPe 2.06: d2wila_
  • Chain 'B':
    Compound: cholinesterase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06276 (Start-528)
      • engineered mutation (16)
      • engineered mutation (480)
    Domains in SCOPe 2.06: d2wilb_
  • Heterogens: TCX, NAG, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wilA (A:)
    eddiiiatkngkvrgmqltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatk
    yansccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqt
    gtsslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqk
    niaafggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyear
    nrtlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdflt
    dmpdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpg
    vsefgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyy
    fehrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnp
    qetqnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wilA (A:)
    ddiiiatkngkvrgmqltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatky
    ansccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtg
    tsslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqkn
    iaafggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearn
    rtlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltd
    mpdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgv
    sefgkesilfhytdwvqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
    rssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpqet
    qnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wilB (B:)
    eddiiiatkngkvrgmqltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatk
    yansccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqt
    gtsslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqk
    niaafggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyear
    nrtlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdflt
    dmpdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpg
    vsefgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyy
    fehrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnp
    qetqnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wilB (B:)
    iiiatkngkvrgmqltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
    sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
    slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
    afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
    lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
    dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
    fgkesilfhytdwvqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfehrs
    sklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpqetqn
    nstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv