PDB entry 2whj

View 2whj on RCSB PDB site
Description: understanding how diverse mannanases recognise heterogeneous substrates
Class: hydrolase
Keywords: mannanase, glycoside hydrolase, hydrolase
Deposited on 2009-05-05, released 2009-05-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.122
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-mannanase
    Species: BACILLUS AGARADHAERENS [TaxId:76935]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5YEX6 (1-307)
      • expression tag (0)
      • conflict (20)
      • conflict (66)
      • conflict (97)
      • conflict (132)
      • conflict (185)
      • conflict (255)
      • conflict (269)
      • conflict (283)
      • conflict (302)
    Domains in SCOPe 2.06: d2whja1, d2whja2
  • Heterogens: GOL, ACT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2whjA (A:)
    agfyvdgntlydangqpfvmrginhghawykdtastaipaiaeqgantirivlsdggqwe
    kddidtirevielaeqnkmvavvevhdatgrdsrsdlnravdywiemkdaligkedtvii
    nianewygswdgsawadgyidvipklrdaglthtlmvdaagwgqypqsihdygqdvfnad
    plkntmfsihmyeyaggdantvrsnidrvidqdlalvigefghrhtdgdvdedtilsyse
    etgtgwlawswkgnstewdyldlsedwagqhltdwgnrivhgadglqetskpstvftddn
    gghpeppt