PDB entry 2whh

View 2whh on RCSB PDB site
Description: hiv-1 protease tethered dimer q-product complex along with nucleophilic water molecule
Class: hydrolase
Keywords: protease, hydrolase, drug design, transferase, nucleotidyltransferase, RNA-directed DNA polymerase, catalytic mechanism, multifunctional enzyme, transition state, aspartyl protease
Deposited on 2009-05-05, released 2009-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.2193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pol protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QJ78 (104-202)
      • conflict (2)
      • conflict (61)
      • conflict (94)
      • conflict (106)
      • conflict (165)
      • engineered mutation (198)
    • PDB 2WHH
    Domains in SCOPe 2.07: d2whha1, d2whha2
  • Heterogens: GLU, PPN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2whhA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigmtlnfggssgpqvtlwqrplvtikig
    gqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqydqilieicghkaigtvl
    vgptpvniigrnlltqigatlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2whhA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigmtlnfpqvtlwqrplvtikiggqlke
    alldtgaddtvleemslpgrwkpkmiggiggfikvrqydqilieicghkaigtvlvgptp
    vniigrnlltqigatlnf