PDB entry 2wgs

View 2wgs on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor.
Class: ligase
Keywords: relaxed state, purine analogue, nucleotide-binding, glna1, mt2278, ligase, rv2220, cytoplasm, synthetase
Deposited on 2009-04-27, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.23098
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGS
    • Uniprot P0A590 (Start-485)
    Domains in SCOPe 2.07: d2wgsa1, d2wgsa2
  • Chain 'B':
    Compound: glutamine synthetase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGS
    • Uniprot P0A590 (Start-485)
    Domains in SCOPe 2.07: d2wgsb1, d2wgsb2
  • Chain 'C':
    Compound: glutamine synthetase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGS
    • Uniprot P0A590 (Start-485)
    Domains in SCOPe 2.07: d2wgsc1, d2wgsc2
  • Chain 'D':
    Compound: glutamine synthetase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGS
    • Uniprot P0A590 (Start-485)
    Domains in SCOPe 2.07: d2wgsd1, d2wgsd2
  • Chain 'E':
    Compound: glutamine synthetase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGS
    • Uniprot P0A590 (Start-485)
    Domains in SCOPe 2.07: d2wgse1, d2wgse2
  • Chain 'F':
    Compound: glutamine synthetase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGS
    • Uniprot P0A590 (Start-485)
    Domains in SCOPe 2.07: d2wgsf1, d2wgsf2
  • Chain 'G':
    Compound: glutamine synthetase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGS
    • Uniprot P0A590 (Start-485)
    Domains in SCOPe 2.07: d2wgsg1, d2wgsg2
  • Chain 'H':
    Compound: glutamine synthetase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGS
    • Uniprot P0A590 (Start-485)
    Domains in SCOPe 2.07: d2wgsh1, d2wgsh2
  • Chain 'I':
    Compound: glutamine synthetase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGS
    • Uniprot P0A590 (Start-485)
    Domains in SCOPe 2.07: d2wgsi1, d2wgsi2
  • Chain 'J':
    Compound: glutamine synthetase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGS
    • Uniprot P0A590 (Start-485)
    Domains in SCOPe 2.07: d2wgsj1, d2wgsj2
  • Chain 'K':
    Compound: glutamine synthetase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGS
    • Uniprot P0A590 (Start-485)
    Domains in SCOPe 2.07: d2wgsk1, d2wgsk2
  • Chain 'L':
    Compound: glutamine synthetase 1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGS
    • Uniprot P0A590 (Start-485)
    Domains in SCOPe 2.07: d2wgsl1, d2wgsl2
  • Heterogens: 1AZ, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wgsA (A:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgsA (A:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    dmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadt
    ayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyf
    pvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmqlyky
    iikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtarhyig
    gllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkakrlef
    rspdssgnpylafsamlmagldgiknkiepqapvdkdaasipqtptqlsdvidrleadhe
    ylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wgsB (B:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgsB (B:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    dmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadt
    ayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyf
    pvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmqlyky
    iikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtarhyig
    gllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkakrlef
    rspdssgnpylafsamlmagldgiknkiepqapvdkdaasipqtptqlsdvidrleadhe
    ylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wgsC (C:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgsC (C:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    dmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadt
    ayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyf
    pvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmqlyky
    iikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtarhyig
    gllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkakrlef
    rspdssgnpylafsamlmagldgiknkiepqapvdkdaasipqtptqlsdvidrleadhe
    ylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wgsD (D:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgsD (D:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    dmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadt
    ayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyf
    pvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmqlyky
    iikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtarhyig
    gllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkakrlef
    rspdssgnpylafsamlmagldgiknkiepqapvdkdaasipqtptqlsdvidrleadhe
    ylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wgsE (E:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgsE (E:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    dmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadt
    ayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyf
    pvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmqlyky
    iikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtarhyig
    gllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkakrlef
    rspdssgnpylafsamlmagldgiknkiepqapvdkdaasipqtptqlsdvidrleadhe
    ylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wgsF (F:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgsF (F:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    dmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadt
    ayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyf
    pvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmqlyky
    iikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtarhyig
    gllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkakrlef
    rspdssgnpylafsamlmagldgiknkiepqapvdkdaasipqtptqlsdvidrleadhe
    ylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2wgsG (G:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgsG (G:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    dmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadt
    ayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyf
    pvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmqlyky
    iikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtarhyig
    gllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkakrlef
    rspdssgnpylafsamlmagldgiknkiepqapvdkdaasipqtptqlsdvidrleadhe
    ylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2wgsH (H:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgsH (H:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    dmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadt
    ayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyf
    pvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmqlyky
    iikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtarhyig
    gllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkakrlef
    rspdssgnpylafsamlmagldgiknkiepqapvdkdaasipqtptqlsdvidrleadhe
    ylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2wgsI (I:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgsI (I:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    dmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadt
    ayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyf
    pvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmqlyky
    iikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtarhyig
    gllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkakrlef
    rspdssgnpylafsamlmagldgiknkiepqapvdkdaasipqtptqlsdvidrleadhe
    ylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2wgsJ (J:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgsJ (J:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    dmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadt
    ayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyf
    pvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmqlyky
    iikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtarhyig
    gllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkakrlef
    rspdssgnpylafsamlmagldgiknkiepqapvdkdaasipqtptqlsdvidrleadhe
    ylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2wgsK (K:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgsK (K:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    dmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadt
    ayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyf
    pvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmqlyky
    iikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtarhyig
    gllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkakrlef
    rspdssgnpylafsamlmagldgiknkiepqapvdkdaasipqtptqlsdvidrleadhe
    ylteggvftndlietwisfkreneiepvnirphpyefalyydv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2wgsL (L:)
    mahhhhhhgtektpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddgla
    fdgssirgfqsihesdmlllpdpetaridpfraaktlninffvhdpftlepysrdprnia
    rkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadg
    spnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqf
    nsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmyde
    tgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvr
    ipitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkdlyelppee
    aasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvnirphpyef
    alyydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgsL (L:)
    ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
    dmlllpdpetaridpfraaktlninffvhdpftlepysrdprniarkaenylistgiadt
    ayfgaeaefyifdsvsfdsrangsfyevdaisgwwntgaateadgspnrgykvrhkggyf
    pvapndqyvdlrdkmltnlinsgfilekghhevgsggqaeinyqfnsllhaaddmqlyky
    iikntawqngktvtfmpkplfgdngsgmhchqslwkdgaplmydetgyaglsdtarhyig
    gllhhapsllaftnptvnsykrlvpgyeapinlvysqrnrsacvripitgsnpkakrlef
    rspdssgnpylafsamlmagldgiknkiepqapvdkdaasipqtptqlsdvidrleadhe
    ylteggvftndlietwisfkreneiepvnirphpyefalyydv