PDB entry 2wfb

View 2wfb on RCSB PDB site
Description: high resolution structure of the apo form of the orange protein (orp) from desulfovibrio gigas
Class: biosynthetic protein
Keywords: mixed molybdenum-copper sulphide cluster, alpha and beta protein, biosynthetic protein
Deposited on 2009-04-03, released 2010-05-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18585
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative uncharacterized protein orp
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5DUA6 (3-119)
      • expression tag (0-2)
    Domains in SCOPe 2.01: d2wfba_
  • Heterogens: PO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wfbA (A:)
    ashmqriavtaegpgldglvdprfgraagfvvvdaatmaaeyvdngasqtlshgaginaa
    qvlaksgagvlltgyvgpkafqalqaagikvgqdlegltvrqavqrfldgqvpmaagpnk