PDB entry 2wf6

View 2wf6 on RCSB PDB site
Description: structure of beta-phosphoglucomutase inhibited with glucose-6-phospahte and aluminium tetrafluoride
Class: isomerase
Keywords: isomerase, phosphotransferase, transition state analogue, haloacid dehalogenase superfamily
Deposited on 2009-04-03, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.163
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-End)
      • conflict (124)
      • conflict (205)
    Domains in SCOPe 2.07: d2wf6a_
  • Heterogens: ALF, MG, BG6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wf6A (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wf6A (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlq