PDB entry 2wf5

View 2wf5 on RCSB PDB site
Description: structure of beta-phosphoglucomutase inhibited with glucose-6-phospahte and trifluoromagnesate
Class: isomerase
Keywords: isomerase, phosphotransferase, magnesium fluoride, transition state analogue, haloacid dehalogenase superfamily
Deposited on 2009-04-03, released 2009-09-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.1736
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-End)
      • conflict (124)
      • conflict (205)
    Domains in SCOPe 2.01: d2wf5a_
  • Heterogens: BG6, MG, MGF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wf5A (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wf5A (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlq