PDB entry 2wc2

View 2wc2 on RCSB PDB site
Description: nmr structure of catabolite activator protein in the unliganded state
Class: transcription regulator
Keywords: transcription regulator, transctiption factor, transcription regulation, cyclic nucleotide-binding protein, camp-binding, transcription, allosteric protein, catabolite activator protein, nucleotide-binding, DNA-binding protein, camp, activator, acetylation, DNA-binding
Deposited on 2009-03-06, released 2009-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite gene activator
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wc2a1, d2wc2a2
  • Chain 'B':
    Compound: Catabolite gene activator
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wc2b1, d2wc2b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wc2A (A:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wc2B (B:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr