PDB entry 2wbw

View 2wbw on RCSB PDB site
Description: Ad37 fibre head in complex with CAR D1 and sialic acid
Class: structural protein
Keywords: immunoglobulin domain, transmembrane, phosphoprotein, disulfide bond, phosphorylation, hemagglutination, structural protein, receptor, palmitate, adenovirus, erythrocyte, lipoprotein, sialic acid, glycoprotein, cell junction, cell membrane, cell adhesion, car, ad37, had37, complex, membrane, secreted, tight junction, red blood cell, coxsackievirus, host-virus interaction, viral protein-receptor complex
Deposited on 2009-03-05, released 2009-03-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.171
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fiber protein
    Species: HUMAN ADENOVIRUS 37 [TaxId:52275]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2WBW
    • Uniprot Q80S15 (Start-193)
    Domains in SCOPe 2.07: d2wbwa_
  • Chain 'B':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wbwb_
  • Heterogens: SIA, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wbwA (A:)
    gamgswnpkydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyh
    iinnktnpkiksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlv
    aypkpsnskkyardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenve
    fettsftfsyiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wbwA (A:)
    rtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkiks
    ftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskkya
    rdivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyia
    qe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wbwB (B:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wbwB (B:)
    slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
    iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvl