PDB entry 2wbm

View 2wbm on RCSB PDB site
Description: crystal structure of mthsbds, the homologue of the shwachman-bodian-diamond syndrome protein in the euriarchaeon methanothermobacter thermautotrophicus
Class: RNA-binding protein
Keywords: shwachman-bodian-diamond syndrome protein, ribosome binding, conformational flexibility, RNA-binding protein
Deposited on 2009-03-02, released 2009-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.191
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome maturation protein sdo1 homolog
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2WBM (Start-19)
      • conflict see remark 9 (194)
    • Uniprot O26781 (20-251)
    Domains in SCOPe 2.06: d2wbma1, d2wbma2, d2wbma3, d2wbma4
  • Chain 'B':
    Compound: ribosome maturation protein sdo1 homolog
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2WBM
      • conflict see remark 9 (194)
    • Uniprot O26781 (20-251)
    Domains in SCOPe 2.06: d2wbmb1, d2wbmb2, d2wbmb3
  • Heterogens: GOL, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wbmA (A:)
    mgsshhhhhhssglvprgshmvsledaviarleshgerfevlvdpdlaaefrredsdvsv
    edvlavqevfrdarkgdkaseeamrkvfetadplevtpvilrrgtiqltaeqrrqmiedk
    rlkiinkiareainpqnglphppkriekameearvhvdpfktvdeqvnivlkairtkipi
    kfekvrvaikipgemagsaygvisnfgkitneewqndgswiavveipgglqdsfyqklse
    ltggnvetrlik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wbmA (A:)
    shmvsledaviarleshgerfevlvdpdlaaefrredsdvsvedvlavqevfrdarkgdk
    aseeamrkvfetadplevtpvilrrgtiqltaeqrrqmiedkrlkiinkiareainpqng
    lphppkriekameearvhvdpfktvdeqvnivlkairtkipikfekvrvaikipgemags
    aygvisnfgkitneewqndgswiavveipgglqdsfyqklseltggnvetrlik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wbmB (B:)
    mgsshhhhhhssglvprgshmvsledaviarleshgerfevlvdpdlaaefrredsdvsv
    edvlavqevfrdarkgdkaseeamrkvfetadplevtpvilrrgtiqltaeqrrqmiedk
    rlkiinkiareainpqnglphppkriekameearvhvdpfktvdeqvnivlkairtkipi
    kfekvrvaikipgemagsaygvisnfgkitneewqndgswiavveipgglqdsfyqklse
    ltggnvetrlik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wbmB (B:)
    mvsledaviarleshgerfevlvdpdlaaefrvsvedvlavqevfrdarkgdkaseeamr
    kvfetadplevtpvilrrgtiqltaeqrrqmiedkrlkiinkiareainpqnglphppkr
    iekameearvhvdpfktvdeqvnivlkairtkipikfekvrvaikipgemagsaygvisn
    fgkitneewqndgswiavveipgglqdsfyqklseltggnvetrlik