PDB entry 2wbl

View 2wbl on RCSB PDB site
Description: three-dimensional structure of a binary rop-prone complex
Class: signaling protein
Keywords: membrane, prenylation, methylation, nucleotide- binding, signaling protein, nucleotide-binding, complex of prone-gef with rop substrate, lipoprotein, GTP-binding
Deposited on 2009-03-02, released 2009-04-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.217
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rho of plants guanine nucleotide exchange factor 8
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: rho of plants guanine nucleotide exchange factor 8
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: rac-like GTP-binding protein arac2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38903 (Start-179)
      • see remark 999 (27)
    Domains in SCOPe 2.05: d2wblc_
  • Chain 'D':
    Compound: rac-like GTP-binding protein arac2
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38903 (Start-179)
      • see remark 999 (27)
    Domains in SCOPe 2.05: d2wbld_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wblC (C:)
    mstarfikcvtvgdgavgktcmlisytgntfptdyvptvfdnfsanvvvdgstvnlglwd
    tagqedynrlrplsyrgadvfllafsliskasyenihkkwlpelkhyapgipivlvgtkl
    dlrddkqflkdhpgaasittaqgeelrkmigavrylecssktqqnvkavfdtairvalrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wblC (C:)
    rfikcvtvgdgavgktcmlisytgptvfdnfsanvvvdgstvnlglwdtagqedynrlrp
    lsyrgadvfllafsliskasyenihkkwlpelkhyapgipivlvgtkldlrddkqflkdh
    pgaasittaqgeelrkmigavrylecssktqqnvkavfdtairvalrp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wblD (D:)
    mstarfikcvtvgdgavgktcmlisytgntfptdyvptvfdnfsanvvvdgstvnlglwd
    tagqedynrlrplsyrgadvfllafsliskasyenihkkwlpelkhyapgipivlvgtkl
    dlrddkqflkdhpgaasittaqgeelrkmigavrylecssktqqnvkavfdtairvalrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wblD (D:)
    arfikcvtvgdgavgktcmlisytgptvfdnfsanvvvdgstvnlglwdtagqedynrlr
    plsyrgadvfllafsliskasyenihkkwlpelkhyapgipivlvgtkldlrddkqflkd
    hpgaasittaqgeelrkmigavrylecssktqqnvkavfdtairvalrp