PDB entry 2wbk

View 2wbk on RCSB PDB site
Description: Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis
Class: hydrolase
Keywords: glycoside hydrolase, conformational itinerary, hydrolase, mannosidase, beta-mannoside, michaelis complex
Deposited on 2009-03-02, released 2009-03-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.172
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-mannosidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AAK6 (Start-838)
      • engineered mutation (529)
    • PDB 2WBK
    Domains in SCOPe 2.04: d2wbka1, d2wbka2, d2wbka3, d2wbka4, d2wbka5
  • Chain 'B':
    Compound: beta-mannosidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AAK6 (Start-838)
      • engineered mutation (529)
    • PDB 2WBK (839-End)
    Domains in SCOPe 2.04: d2wbkb1, d2wbkb2, d2wbkb3, d2wbkb4, d2wbkb5
  • Heterogens: EDO, CL, M2F, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wbkA (A:)
    qgndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwve
    nedweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvl
    rkgenhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmv
    tsgvwrpvtlrfydiatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvsln
    gttvtevkqqvtlqpginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqs
    hriglrtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmk
    eanmnmvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavyni
    rrlrnhaslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefds
    drfyvhsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsqfgfqsfpemk
    tiaafaapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgm
    rhgleahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafapvlinpiq
    qndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcvyrakldg
    wltpedcrrsflklilkdksghqvaesvhffrktkdlqlpptsvsyqmkqtdgkceltlf
    ssmlakdifietplqgarysdnffdllpgerkkviitsprikkgeelpvnikhiretykl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wbkA (A:)
    ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
    dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
    genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
    gvwrpvtlrfydiatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngt
    tvtevkqqvtlqpginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshr
    iglrtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkea
    nmnmvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirr
    lrnhaslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdr
    fyvhsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsqfgfqsfpemkti
    aafaapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrh
    gleahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafapvlinpiqqn
    dslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcvyrakldgwl
    tpedcrrsflklilkdksghqvaesvhffrktkdlqlpptsvsyqmkqtdgkceltlfss
    mlakdifietplqgarysdnffdllpgerkkviitsprikkgeelpvnikhiretyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wbkB (B:)
    qgndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwve
    nedweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvl
    rkgenhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmv
    tsgvwrpvtlrfydiatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvsln
    gttvtevkqqvtlqpginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqs
    hriglrtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmk
    eanmnmvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavyni
    rrlrnhaslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefds
    drfyvhsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsqfgfqsfpemk
    tiaafaapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgm
    rhgleahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafapvlinpiq
    qndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcvyrakldg
    wltpedcrrsflklilkdksghqvaesvhffrktkdlqlpptsvsyqmkqtdgkceltlf
    ssmlakdifietplqgarysdnffdllpgerkkviitsprikkgeelpvnikhiretykl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wbkB (B:)
    gndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwven
    edweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlr
    kgenhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvt
    sgvwrpvtlrfydiatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslng
    ttvtevkqqvtlqpginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqsh
    riglrtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmke
    anmnmvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynir
    rlrnhaslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsd
    rfyvhsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsqfgfqsfpemkt
    iaafaapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmr
    hgleahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafapvlinpiqq
    ndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcvyrakldgw
    ltpedcrrsflklilkdksghqvaesvhffrktkdlqlpptsvsyqmkqtdgkceltlfs
    smlakdifietplqgarysdnffdllpgerkkviitsprikkgeelpvnikhiretykle