PDB entry 2wbi

View 2wbi on RCSB PDB site
Description: Crystal structure of human acyl-CoA dehydrogenase 11
Class: oxidoreductase
Keywords: human, acyl-coa, dehydrogenase, phosphoprotein, oxidoreductase
Deposited on 2009-02-28, released 2009-05-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-coa dehydrogenase family member 11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wbia1, d2wbia2
  • Chain 'B':
    Compound: acyl-coa dehydrogenase family member 11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2wbib1, d2wbib2
  • Heterogens: FAD, PO4, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wbiA (A:)
    smskrtfstvlpqidttgqlfvqtrkgqevlikvkhfmkqhilpaekevtefyvqnensv
    dkwgkplvidklkemakveglwnlflpavsglshvdyaliaeetgkcffapdvfncqapd
    tgnmevlhlygseeqkkqwlepllqgnitscfcmtepdvassdatniecsiqrdedsyvi
    ngkkwwssgagnpkckiaivlgrtqntslsrhkqhsmilvpmntpgvkiirplsvfgytd
    nfhgghfeihfnqvrvpatnlilgegrgfeisqgrlgpgrihhcmrtvglaeralqimce
    ratqriafkkklyahevvahwiaesriaiekirlltlkaahsmdtlgsagakkeiamikv
    aapravskivdwaiqvcggagvsqdyplanmyaitrvlrladgpdevhlsaiatmelrdq
    akrltaki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wbiA (A:)
    vqtrkgqevlikvkhfmkqhilpaekevtekwgkplvidklkemakveglwnlflpavsg
    lshvdyaliaeetgkcffapdvfncqapdtgnmevlhlygseeqkkqwlepllqgnitsc
    fcmtepdvassdatniecsiqrdedsyvingkkwwssgagnpkckiaivlgrtqntslsr
    hkqhsmilvpmntpgvkiirplsvfgytdnfhgghfeihfnqvrvpatnlilgegrgfei
    sqgrlgpgrihhcmrtvglaeralqimceratqriafkkklyahevvahwiaesriaiek
    irlltlkaahsmdtlgsagakkeiamikvaapravskivdwaiqvcggagvsqdyplanm
    yaitrvlrladgpdevhlsaiatmelrdqakrlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wbiB (B:)
    smskrtfstvlpqidttgqlfvqtrkgqevlikvkhfmkqhilpaekevtefyvqnensv
    dkwgkplvidklkemakveglwnlflpavsglshvdyaliaeetgkcffapdvfncqapd
    tgnmevlhlygseeqkkqwlepllqgnitscfcmtepdvassdatniecsiqrdedsyvi
    ngkkwwssgagnpkckiaivlgrtqntslsrhkqhsmilvpmntpgvkiirplsvfgytd
    nfhgghfeihfnqvrvpatnlilgegrgfeisqgrlgpgrihhcmrtvglaeralqimce
    ratqriafkkklyahevvahwiaesriaiekirlltlkaahsmdtlgsagakkeiamikv
    aapravskivdwaiqvcggagvsqdyplanmyaitrvlrladgpdevhlsaiatmelrdq
    akrltaki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wbiB (B:)
    vqtrkgqevlikvkhfmkqhilpaekevtefyvqnensvdkwgkplvidklkemakvegl
    wnlflpavsglshvdyaliaeetgkcffapdvfncqapdtgnmevlhlygseeqkkqwle
    pllqgnitscfcmtepdvassdatniecsiqrdedsyvingkkwwssgagnpkckiaivl
    grtqntsqhsmilvpmntpgvkiirplsvfgytdnfhgghfeihfnqvrvpatnlilgeg
    rgfeisqgrlgpgrihhcmrtvglaeralqimceratqriafkkklyahevvahwiaesr
    iaiekirlltlkaahsmdtlgsagakkeiamikvaapravskivdwaiqvcggagvsqdy
    planmyaitrvlrladgpdevhlsaiatmelrdqakrl