PDB entry 2wah

View 2wah on RCSB PDB site
Description: crystal structure of an igg1 fc glycoform (man9glcnac2)
Class: immune system
Keywords: immunoglobulin c region, antibody engineering, immunoglobulin domain, secreted, antibody, kifunensine, glycoprotein, oligomannose, immune system, glycosylation
Deposited on 2009-02-06, released 2009-03-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (156)
    Domains in SCOPe 2.04: d2waha1, d2waha2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-208)
      • engineered mutation (156)
    Domains in SCOPe 2.04: d2wahb1, d2wahb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wahA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykatppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslslsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wahA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
    styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrde
    ltknqvsltclvkgfypsdiavewesngqpennykatppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wahB (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykatppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslslsp